ABIN632109

antibody from antibodies-online

Targeting: DCAF12 CT102, DKFZP434O125, KIAA1892, MGC1058, TCC52, WDR40A

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632109 - Provider product page
Provider: antibodies-online
Product name: anti-DDB1 and CUL4 Associated Factor 12 (DCAF12) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: WDR40 A antibody was raised using the middle region of WDR40 corresponding to a region with amino acids TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

DCAF12 protein structure - ABIN632109 shown in red.