ABIN503229
antibody from antibodies-online
Targeting: DCAF12
CT102, DKFZP434O125, KIAA1892, MGC1058, TCC52, WDR40A
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503229 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DDB1 and CUL4 Associated Factor 12 (DCAF12) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-WDR40A antibody: synthetic peptide directed towards the N terminal of human WDR40A
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKR
KRLPP VKRSLVYYLK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references High-throughput mapping of a dynamic signaling network in mammalian cells.
Barrios-Rodiles M, Brown KR, Ozdamar B, Bose R, Liu Z, Donovan RS, Shinjo F, Liu Y, Dembowy J, Taylor IW, Luga V, Przulj N, Robinson M, Suzuki H, Hayashizaki Y, Jurisica I, Wrana JL
Science (New York, N.Y.) 2005 Mar 11;307(5715):1621-5
Science (New York, N.Y.) 2005 Mar 11;307(5715):1621-5
No comments: Submit comment
No validations: Submit validation data