HPA016596

DCAF12 antibody from MilliporeSigma / Merck KGaA
CT102, DKFZP434O125, KIAA1892, MGC1058, TCC52, WDR40A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016596
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA016596, RRID:AB_1852438
Product name
Anti-WDR40A antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA016596
Antibody type
Polyclonal
Antigen
WD repeat-containing protein 40A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDGHKDWIFSIAWISDTMAVSGSRDGSMGLWEVTD
DVLTKSDARHNVSRVPVYAHITHKALKDIPKEDTN
PDNCKVRALAFNNKNKELGAVSLD
Storage
-20C
Provider Type Product Number
- No reagents -