HPA018174

HHATL antibody from Sigma-Aldrich
C3orf3, GUP1, KIAA1173, MBOAT3, MSTP002, OACT3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018174
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018174, RRID:AB_2116671
Product name
Anti-HHATL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018174
Antibody type
Polyclonal
Antigen
Protein-cysteine N-palmitoyltransferase HHAT-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTV
LRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFF
GPIMTFDRFHAQVSQVEPVRREGELWHIRAQ
Storage
-20C
Provider Type Product Number
- No reagents -