HPA024221

SZRD1 antibody from Sigma-Aldrich
C1orf144, DKFZp566C0424
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024221
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024221, RRID:AB_10603450
Product name
Anti-C1orf144 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024221
Antibody type
Polyclonal
Antigen
UPF0485 protein C1orf144 (Putative MAPK-activating protein PM18/PM20/PM22) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PNSTSRPTLPVKSLAQREAEYAEARKRILGSASPE
EEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDG
SQGFKQR
Storage
-20C
Provider Type Product Number
- No reagents -