HPA017587

NDRG4 antibody from Sigma-Aldrich
KIAA1180, SMAP-8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017587
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017587, RRID:AB_1854344
Product name
Anti-NDRG4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017587
Antibody type
Polyclonal
Antigen
Protein NDRG4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQV
GASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIG
IGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKG
WIDWAATKLSGLTSTLPD
Storage
-20C
Provider Type Product Number
- No reagents -