HPA003123

MB antibody from Sigma-Aldrich
PVALB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003123
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003123, RRID:AB_1079442
Product name
Anti-MB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003123
Antibody type
Polyclonal
Antigen
Myoglobin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPE
TLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALG
GILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFIS
ECIIQVLQSKHPGDFGADA
Storage
-20C
Provider Type Product Number
- No reagents -