H00003357-M09

HTR2B antibody from Abnova Corporation
5-HT(2B), 5-HT2B
No application information provided.

Antibody data

Product number
H00003357-M09
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003357-M09, RRID:AB_1137262
Product name
HTR2B monoclonal antibody (M09), clone 4F3
Provider product page
Abnova Corporation - H00003357-M09
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HTR2B.
Antigen sequence
VDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIM
IVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVF
QRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMR
RTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWC
PFFITNITLVLCDSCNQTTLQ
Isotype
IgG
Antibody clone number
4F3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -