ABIN486809

HTR2B antibody from antibodies-online
5-HT(2B), 5-HT2B
Western blot
Data presented on provider website
Immunocytochemistry
Recommended by provider

Antibody data

Product number
ABIN486809
Provider
antibodies-online
Product name
anti-Serotonin Receptor 2B (HTR2B) (N-Term) antibody
Provider product page
antibodies-online - ABIN486809
Antibody type
Polyclonal
Antigen
The immunogen for anti-HTR2B antibody: synthetic peptide directed towards the N terminal of human HTR2B
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTI
GGNTL VILAVSLEKK
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -