HPA012867

HTR2B antibody from Sigma-Aldrich
5-HT(2B), 5-HT2B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012867
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012867, RRID:AB_1856710
Product name
Anti-HTR2B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012867
Antibody type
Polyclonal
Antigen
5-hydroxytryptamine receptor 2B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETP
CSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIG
KKSVQTISNEQRASKVL
Storage
-20C
Provider Type Product Number
- No reagents -