HPA012867

HTR2B antibody from Atlas Antibodies
5-HT(2B), 5-HT2B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012867
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012867, RRID:AB_1856710
Product name
Anti-HTR2B
Provider product page
Atlas Antibodies - HPA012867
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETP
CSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIG
KKSVQTISNEQRASKVL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -