HPA013185

GPR158 antibody from Sigma-Aldrich
KIAA1136
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013185
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013185, RRID:AB_2113957
Product name
Anti-GPR158 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013185
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 158 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGLAGKTQTAGVEERTKSQKPLPKDKETNRNHSNS
DNTETKDPAPQNSNPAEEPRKPQKSGIMKQQRVNP
TTANSDLNPGTTQMKDNFDIGEVCPWEVYDLTPGP
VPSESKVQKHVSIVASEMEKNPTFSLKEKSHHKP
Storage
-20C
Provider Type Product Number
- No reagents -