Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00284119-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00284119-M02, RRID:AB_606890
- Product name
- PTRF monoclonal antibody (M02), clone 1F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PTRF.
- Antigen sequence
KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTR
HTLEKRMNKLGTRLVPAERREKLKTSRDKLRKSFT
PDHVVYARSKTAVYKVPPF- Isotype
- IgG
- Antibody clone number
- 1F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SDPR induces membrane curvature and functions in the formation of caveolae.
Hansen CG, Bright NA, Howard G, Nichols BJ
Nature cell biology 2009 Jul;11(7):807-14
Nature cell biology 2009 Jul;11(7):807-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PTRF on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol