HPA015650

RTN3 antibody from Sigma-Aldrich
ASYIP, HAP, NSPL2, NSPLII, RTN3-A1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015650
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015650, RRID:AB_1856499
Product name
Anti-RTN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015650
Antibody type
Polyclonal
Antigen
Reticulon-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILA
KEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAG
VHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETK
NPNGVSSREAKTALDADDRFTLLTAQKPPTEY
Storage
-20C
Provider Type Product Number
- No reagents -