HPA015240

NMNAT2 antibody from Sigma-Aldrich
C1orf15, KIAA0479, PNAT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015240
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015240, RRID:AB_1854533
Product name
Anti-NMNAT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015240
Antibody type
Polyclonal
Antigen
Nicotinamide mononucleotide adenylyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGRFIVIGGIVSPVHDSYGKQGLVSSRHRLIMCQL
AVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMK
RVTGCILSNVNTPSMTPVIGQPQNETPQPIYQNSN
VATKPTAAKILGKVGESLSRICCVRPPVERFTFVD
ENANLGTVM
Storage
-20C
Provider Type Product Number
- No reagents -