HPA017977

CTNNA3 antibody from Sigma-Aldrich
MGC26194, VR22
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017977
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017977, RRID:AB_1846065
Product name
Anti-CTNNA3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017977
Antibody type
Polyclonal
Antigen
Catenin alpha-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVSESHILEDVNKCIIALRDQDADNLDRAAGAIRG
RAARVAHIVTGEMDSYEPGAYTEGVMRNVNFLTST
VIPEFVTQVNVALEALSKSSLNVLDDNQFVDISKK
IYDTIHDIRCSVMMIRTPEELEDVSDLEEEHEVRS
HTSIQTEGK
Storage
-20C
Provider Type Product Number
- No reagents -