Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000514-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000514-M01, RRID:AB_425319
- Product name
- ATP5E monoclonal antibody (M01), clone 2F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ATP5E.
- Antigen sequence
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANA
EKTSGSNVKIVKVKKE- Isotype
- IgG
- Antibody clone number
- 2F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Assessing actual contribution of IF1, inhibitor of mitochondrial FoF1, to ATP homeostasis, cell growth, mitochondrial morphology, and cell viability.
Mitochondrial ATP synthase deficiency due to a mutation in the ATP5E gene for the F1 epsilon subunit.
Knockdown of F1 epsilon subunit decreases mitochondrial content of ATP synthase and leads to accumulation of subunit c.
Fujikawa M, Imamura H, Nakamura J, Yoshida M
The Journal of biological chemistry 2012 May 25;287(22):18781-7
The Journal of biological chemistry 2012 May 25;287(22):18781-7
Mitochondrial ATP synthase deficiency due to a mutation in the ATP5E gene for the F1 epsilon subunit.
Mayr JA, Havlícková V, Zimmermann F, Magler I, Kaplanová V, Jesina P, Pecinová A, Nusková H, Koch J, Sperl W, Houstek J
Human molecular genetics 2010 Sep 1;19(17):3430-9
Human molecular genetics 2010 Sep 1;19(17):3430-9
Knockdown of F1 epsilon subunit decreases mitochondrial content of ATP synthase and leads to accumulation of subunit c.
Havlícková V, Kaplanová V, Nůsková H, Drahota Z, Houstek J
Biochimica et biophysica acta 2010 Jun-Jul;1797(6-7):1124-9
Biochimica et biophysica acta 2010 Jun-Jul;1797(6-7):1124-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ATP5E monoclonal antibody (M01), clone 2F3 Western Blot analysis of ATP5E expression in SW-13 ( Cat # L005V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ATP5E on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol