Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405392 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Frizzled Family Receptor 10 (FZD10) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHE
FAPLV EYGCHGHLRF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Spatio-temporal expression pattern of frizzled receptors after contusive spinal cord injury in adult rats.
Autosomal dominant familial exudative vitreoretinopathy in two Japanese families with FZD4 mutations (H69Y and C181R).
Gonzalez P, Fernandez-Martos CM, Gonzalez-Fernandez C, Arenas E, Rodriguez FJ
PloS one 2012;7(12):e50793
PloS one 2012;7(12):e50793
Autosomal dominant familial exudative vitreoretinopathy in two Japanese families with FZD4 mutations (H69Y and C181R).
Omoto S, Hayashi T, Kitahara K, Takeuchi T, Ueoka Y
Ophthalmic genetics 2004 Jun;25(2):81-90
Ophthalmic genetics 2004 Jun;25(2):81-90
No comments: Submit comment
No validations: Submit validation data