HPA014485

FZD10 antibody from Sigma-Aldrich
CD350
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014485
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014485, RRID:AB_1849134
Product name
Anti-FZD10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014485
Antibody type
Polyclonal
Antigen
Frizzled-10 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKA
QHPQKTHHGKYEIPAQSPTCV
Storage
-20C
Provider Type Product Number
- No reagents -