H00029893-B01

PSMC3IP antibody from Abnova Corporation
GT198, Hop2, HUMGT198A, TBPIP

Antibody data

Product number
H00029893-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029893-B01, RRID:AB_1138405
Product name
TBPIP MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00029893-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TBPIP protein.
Antigen sequence
MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGN
LQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKI
YFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQ
SCRYMEAELKELSSALTTPEMQKEIQELKKECAGY
RERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRK
RKRMATELSDAILEGYPKSKKQFFEEVGIETDEDY
NVTLPDP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -