HPA011972

PDGFB antibody from Sigma-Aldrich
SIS, SSV
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011972
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011972, RRID:AB_1855134
Product name
Anti-PDGFB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011972
Antibody type
Polyclonal
Antigen
Platelet-derived growth factor B chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELD
LNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAE
CKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCS
GCCNNRNVQCRPTQVQLRPVQVRKIEIV
Storage
-20C
Provider Type Product Number
- No reagents -