HPA030886

TAL2 antibody from MilliporeSigma / Merck KGaA
bHLHa19
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030886
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030886, RRID:AB_10601596
Product name
Anti-TAL2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030886
Antibody type
Polyclonal
Antigen
T-cell acute lymphocytic leukemia 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHL
PGLEDRTLLENYQVPSPGPSHHIP
Storage
-20C
Provider Type Product Number
- No reagents -