Antibody data

Product number
H00025961-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00025961-M02, RRID:AB_1137334
Product name
NUDT13 monoclonal antibody (M02), clone 1A9
Provider product page
Abnova Corporation - H00025961-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NUDT13.
Antigen sequence
SLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKED
DDACKKAQQTGAFYLFHSLAPLLQTSAHQYLAPRH
SLLELERLLGKFGQDAQRIEDSVLIGCSEQQEAWF
ALDL
Isotype
IgG
Antibody clone number
1A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -