HPA013770

HRH2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013770
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013770, RRID:AB_1851086
Product name
Anti-HRH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013770
Antibody type
Polyclonal
Antigen
Histamine H2 receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSR
TQSREPRQQEEKPLKLQVWSGTEVTAPQGATDR
Storage
-20C
Provider Type Product Number
- No reagents -