Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001831-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001831-M01, RRID:AB_607241
- Product name
- TSC22D3 monoclonal antibody (M01), clone 3A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TSC22D3.
- Antigen sequence
MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSG
ENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMR
QDSLEPVLRDPCYLINEGICNRNIDQT- Isotype
- IgG
- Antibody clone number
- 3A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of TSC22D3 expression in transfected 293T cell line by TSC22D3 monoclonal antibody (M01), clone 3A5.Lane 1: TSC22D3 transfected lysate(22.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TSC22D3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to TSC22D3 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of TSC22D3 transfected lysate using anti-TSC22D3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TSC22D3 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TSC22D3 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol