Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001831-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001831-M02, RRID:AB_1579938
- Product name
- TSC22D3 monoclonal antibody (M02), clone 2B2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant TSC22D3.
- Antigen sequence
MDLVKNHLMYAVREEVEILKEQIRELVEKNSQLER
ENTLLKTLASPEQLEKFQSCLSLEEPAPESPQVPE
APGGSAV- Isotype
- IgG
- Antibody clone number
- 2B2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Novel p65 binding glucocorticoid-induced leucine zipper peptide suppresses experimental autoimmune encephalomyelitis.
Srinivasan M, Janardhanam S
The Journal of biological chemistry 2011 Dec 30;286(52):44799-810
The Journal of biological chemistry 2011 Dec 30;286(52):44799-810
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TSC22D3 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol