H00001831-M02

TSC22D3 antibody from Abnova Corporation
DIP, DSIPI, GILZ, hDIP, TSC-22R

Antibody data

Product number
H00001831-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001831-M02, RRID:AB_1579938
Product name
TSC22D3 monoclonal antibody (M02), clone 2B2
Provider product page
Abnova Corporation - H00001831-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TSC22D3.
Antigen sequence
MDLVKNHLMYAVREEVEILKEQIRELVEKNSQLER
ENTLLKTLASPEQLEKFQSCLSLEEPAPESPQVPE
APGGSAV
Isotype
IgG
Antibody clone number
2B2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -