Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005887-M10 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005887-M10, RRID:AB_1137406
- Product name
- RAD23B monoclonal antibody (M10), clone 3H7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAD23B.
- Antigen sequence
PQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGG
SGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPE
GLVIQAYFACEKNENLAANFLLQQNFDED- Isotype
- IgG
- Antibody clone number
- 3H7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RAD23B expression in transfected 293T cell line by RAD23B monoclonal antibody (M10), clone 3H7.Lane 1: RAD23B transfected lysate(43.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAD23B is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RAD23B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol