HPA035848

FAM193B antibody from MilliporeSigma / Merck KGaA
FLJ10404, IRIZIO, KIAA1931
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035848
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035848, RRID:AB_10601320
Product name
Anti-FAM193B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035848
Antibody type
Polyclonal
Antigen
family with sequence similarity 193, member B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSTEPKVPNSARAAKRARHKLKKKEKEKAQLAAEA
LKQANRVSGSREPRPARERLLEWPDRELDRVNSFL
SSRLQEIKNTVKDSIRASFSVCE
Storage
-20C
Provider Type Product Number
- No reagents -