HPA014650

TMED9 antibody from Sigma-Aldrich
HSGP25L2G, p24a2, p24alpha2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014650
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014650, RRID:AB_1858066
Product name
Anti-TMED9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014650
Antibody type
Polyclonal
Antigen
Transmembrane emp24 domain-containing protein 9 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQ
PATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTS
HTPGEHQICLHS
Storage
-20C
Provider Type Product Number
- No reagents -