Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014018 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA014018, RRID:AB_1854810
- Product name
- Anti-HCRTR1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYL
WRDYLYPKQYEWV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Toward next generation plasma profiling via heat-induced epitope retrieval and array-based assays.
Schwenk JM, Igel U, Neiman M, Langen H, Becker C, Bjartell A, Ponten F, Wiklund F, Grönberg H, Nilsson P, Uhlen M
Molecular & cellular proteomics : MCP 2010 Nov;9(11):2497-507
Molecular & cellular proteomics : MCP 2010 Nov;9(11):2497-507
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.
- Sample type
- HUMAN