HPA017431

MC3R antibody from Sigma-Aldrich
MC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017431
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017431, RRID:AB_1853616
Product name
Anti-MC3R antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017431
Antibody type
Polyclonal
Antigen
Melanocortin receptor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALL
TAMNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSA
FCEQVFIKPE
Storage
-20C
Provider Type Product Number
- No reagents -