ABIN630411

antibody from antibodies-online

Targeting: MAS1

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630411 - Provider product page
Provider: antibodies-online
Product name: anti-MAS1 Oncogene (MAS1) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

MAS1 protein structure - ABIN630411 shown in red.