Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311405 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-MAS1 Oncogene (MAS1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWAS
HSSKL YIVIMVTIII- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Angiotensin-(1-7) is an endogenous ligand for the G protein-coupled receptor Mas.
Santos RA, Simoes e Silva AC, Maric C, Silva DM, Machado RP, de Buhr I, Heringer-Walther S, Pinheiro SV, Lopes MT, Bader M, Mendes EP, Lemos VS, Campagnole-Santos MJ, Schultheiss HP, Speth R, Walther T
Proceedings of the National Academy of Sciences of the United States of America 2003 Jul 8;100(14):8258-63
Proceedings of the National Academy of Sciences of the United States of America 2003 Jul 8;100(14):8258-63
No comments: Submit comment
No validations: Submit validation data