HPA015963

ADGRB3 antibody from Sigma-Aldrich
BAI3, KIAA0550
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015963
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015963, RRID:AB_1845263
Product name
Anti-BAI3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015963
Antibody type
Polyclonal
Antigen
Brain-specific angiogenesis inhibitor 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSPSQFGCHVLCTWLESCLKSENGRTESCGIMYTK
CTCPQHLGEWGIDDQSLILLNNVVLPLNEQTEGCL
TQELQTTQVCNLTREAKRPPKEEFGMMGDHTIKSQ
RPRSVHEKRVPQEQADAAK
Storage
-20C
Provider Type Product Number
- No reagents -