HPA013820

GABBR2 antibody from Sigma-Aldrich
GABABR2, GPR51, GPRC3B, HG20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013820
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013820, RRID:AB_1849364
Product name
Anti-GABBR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013820
Antibody type
Polyclonal
Antigen
Gamma-aminobutyric acid type B receptor subunit 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITEL
DKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTC
KDPIEDINSPEHIQRRLSLQLPI
Storage
-20C
Provider Type Product Number
- No reagents -