H00011052-M10
antibody from Abnova Corporation
Targeting: CPSF6
CFIM, CFIM68, CFIM72, HPBRII-4, HPBRII-7
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011052-M10 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011052-M10, RRID:AB_606091
- Product name
- CPSF6 monoclonal antibody (M10), clone 3F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CPSF6.
- Antigen sequence
ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPN
VVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGV
NDILEIKFFENRANGQSKGFALVGVGSEAS- Isotype
- IgG
- Antibody clone number
- 3F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Evidence that cleavage factor Im is a heterotetrameric protein complex controlling alternative polyadenylation.
Novel snail1 target proteins in human colon cancer identified by proteomic analysis.
Kim S, Yamamoto J, Chen Y, Aida M, Wada T, Handa H, Yamaguchi Y
Genes to cells : devoted to molecular & cellular mechanisms 2010 Sep 1;15(9):1003-13
Genes to cells : devoted to molecular & cellular mechanisms 2010 Sep 1;15(9):1003-13
Novel snail1 target proteins in human colon cancer identified by proteomic analysis.
Larriba MJ, Casado-Vela J, Pendás-Franco N, Peña R, García de Herreros A, Berciano MT, Lafarga M, Casal JI, Muñoz A
PloS one 2010 Apr 20;5(4):e10221
PloS one 2010 Apr 20;5(4):e10221
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CPSF6 expression in transfected 293T cell line by CPSF6 monoclonal antibody (M10), clone 3F11.Lane 1: CPSF6 transfected lysate(59.21 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CPSF6 monoclonal antibody (M10), clone 3F11. Western Blot analysis of CPSF6 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CPSF6 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CPSF6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol