Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051099-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051099-M02, RRID:AB_605890
- Product name
- ABHD5 monoclonal antibody (M02), clone 4B12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ABHD5.
- Antigen sequence
FEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAK
RPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQ
SLRPHSYVKTIAILGAGHYVYADQPEEFNQKVK- Isotype
- IgG
- Antibody clone number
- 4B12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The cannabinoid receptor agonist THC attenuates weight loss in a rodent model of activity-based anorexia.
Adipose triacylglycerol lipase deletion alters whole body energy metabolism and impairs exercise performance in mice.
Adipose triglyceride lipase regulation of skeletal muscle lipid metabolism and insulin responsiveness.
Verty AN, Evetts MJ, Crouch GJ, McGregor IS, Stefanidis A, Oldfield BJ
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology 2011 Jun;36(7):1349-58
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology 2011 Jun;36(7):1349-58
Adipose triacylglycerol lipase deletion alters whole body energy metabolism and impairs exercise performance in mice.
Huijsman E, van de Par C, Economou C, van der Poel C, Lynch GS, Schoiswohl G, Haemmerle G, Zechner R, Watt MJ
American journal of physiology. Endocrinology and metabolism 2009 Aug;297(2):E505-13
American journal of physiology. Endocrinology and metabolism 2009 Aug;297(2):E505-13
Adipose triglyceride lipase regulation of skeletal muscle lipid metabolism and insulin responsiveness.
Watt MJ, van Denderen BJ, Castelli LA, Bruce CR, Hoy AJ, Kraegen EW, Macaulay L, Kemp BE
Molecular endocrinology (Baltimore, Md.) 2008 May;22(5):1200-12
Molecular endocrinology (Baltimore, Md.) 2008 May;22(5):1200-12
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ABHD5 monoclonal antibody (M02), clone 4B12 Western Blot analysis of ABHD5 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ABHD5 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol