Antibody data
- Antibody Data
- Antigen structure
- References [12]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051099-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051099-M01, RRID:AB_509070
- Product name
- ABHD5 monoclonal antibody (M01), clone 1F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant ABHD5.
- Antigen sequence
MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHL
KEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSH
NISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVY
AFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRC
ALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLIL
VEPWGFPERPDLADQDRPIPVWIRALGAALTPFNP
LAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTV
TEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQR
IGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHS
YVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD- Isotype
- IgG
- Antibody clone number
- 1F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references G0/G1 Switch Gene 2 Regulates Cardiac Lipolysis.
Fatty Acid-binding Proteins Interact with Comparative Gene Identification-58 Linking Lipolysis with Lipid Ligand Shuttling.
MicroRNA-29 fine-tunes the expression of key FOXA2-activated lipid metabolism genes and is dysregulated in animal models of insulin resistance and diabetes.
Perilipins 2 and 3 lack a carboxy-terminal domain present in perilipin 1 involved in sequestering ABHD5 and suppressing basal lipolysis.
The hepatitis C virus core protein inhibits adipose triglyceride lipase (ATGL)-mediated lipid mobilization and enhances the ATGL interaction with comparative gene identification 58 (CGI-58) and lipid droplets.
Endurance exercise training up-regulates lipolytic proteins and reduces triglyceride content in skeletal muscle of obese subjects.
Deficiency of liver Comparative Gene Identification-58 causes steatohepatitis and fibrosis in mice.
Downregulation of adipose triglyceride lipase in the heart aggravates diabetic cardiomyopathy in db/db mice.
Cardiac-specific overexpression of perilipin 5 provokes severe cardiac steatosis via the formation of a lipolytic barrier.
PNPLA1 mutations cause autosomal recessive congenital ichthyosis in golden retriever dogs and humans.
Liver X receptor (LXR) regulates human adipocyte lipolysis.
B56alpha/protein phosphatase 2A inhibits adipose lipolysis in high-fat diet-induced obese mice.
Heier C, Radner FP, Moustafa T, Schreiber R, Grond S, Eichmann TO, Schweiger M, Schmidt A, Cerk IK, Oberer M, Theussl HC, Wojciechowski J, Penninger JM, Zimmermann R, Zechner R
The Journal of biological chemistry 2015 Oct 23;290(43):26141-50
The Journal of biological chemistry 2015 Oct 23;290(43):26141-50
Fatty Acid-binding Proteins Interact with Comparative Gene Identification-58 Linking Lipolysis with Lipid Ligand Shuttling.
Hofer P, Boeszoermenyi A, Jaeger D, Feiler U, Arthanari H, Mayer N, Zehender F, Rechberger G, Oberer M, Zimmermann R, Lass A, Haemmerle G, Breinbauer R, Zechner R, Preiss-Landl K
The Journal of biological chemistry 2015 Jul 24;290(30):18438-53
The Journal of biological chemistry 2015 Jul 24;290(30):18438-53
MicroRNA-29 fine-tunes the expression of key FOXA2-activated lipid metabolism genes and is dysregulated in animal models of insulin resistance and diabetes.
Kurtz CL, Peck BC, Fannin EE, Beysen C, Miao J, Landstreet SR, Ding S, Turaga V, Lund PK, Turner S, Biddinger SB, Vickers KC, Sethupathy P
Diabetes 2014 Sep;63(9):3141-8
Diabetes 2014 Sep;63(9):3141-8
Perilipins 2 and 3 lack a carboxy-terminal domain present in perilipin 1 involved in sequestering ABHD5 and suppressing basal lipolysis.
Patel S, Yang W, Kozusko K, Saudek V, Savage DB
Proceedings of the National Academy of Sciences of the United States of America 2014 Jun 24;111(25):9163-8
Proceedings of the National Academy of Sciences of the United States of America 2014 Jun 24;111(25):9163-8
The hepatitis C virus core protein inhibits adipose triglyceride lipase (ATGL)-mediated lipid mobilization and enhances the ATGL interaction with comparative gene identification 58 (CGI-58) and lipid droplets.
Camus G, Schweiger M, Herker E, Harris C, Kondratowicz AS, Tsou CL, Farese RV Jr, Herath K, Previs SF, Roddy TP, Pinto S, Zechner R, Ott M
The Journal of biological chemistry 2014 Dec 26;289(52):35770-80
The Journal of biological chemistry 2014 Dec 26;289(52):35770-80
Endurance exercise training up-regulates lipolytic proteins and reduces triglyceride content in skeletal muscle of obese subjects.
Louche K, Badin PM, Montastier E, Laurens C, Bourlier V, de Glisezinski I, Thalamas C, Viguerie N, Langin D, Moro C
The Journal of clinical endocrinology and metabolism 2013 Dec;98(12):4863-71
The Journal of clinical endocrinology and metabolism 2013 Dec;98(12):4863-71
Deficiency of liver Comparative Gene Identification-58 causes steatohepatitis and fibrosis in mice.
Guo F, Ma Y, Kadegowda AKG, Betters JL, Xie P, Liu G, Liu X, Miao H, Ou J, Su X, Zheng Z, Xue B, Shi H, Yu L
Journal of lipid research 2013 Aug;54(8):2109-2120
Journal of lipid research 2013 Aug;54(8):2109-2120
Downregulation of adipose triglyceride lipase in the heart aggravates diabetic cardiomyopathy in db/db mice.
Inoue T, Kobayashi K, Inoguchi T, Sonoda N, Maeda Y, Hirata E, Fujimura Y, Miura D, Hirano K, Takayanagi R
Biochemical and biophysical research communications 2013 Aug 16;438(1):224-9
Biochemical and biophysical research communications 2013 Aug 16;438(1):224-9
Cardiac-specific overexpression of perilipin 5 provokes severe cardiac steatosis via the formation of a lipolytic barrier.
Pollak NM, Schweiger M, Jaeger D, Kolb D, Kumari M, Schreiber R, Kolleritsch S, Markolin P, Grabner GF, Heier C, Zierler KA, Rülicke T, Zimmermann R, Lass A, Zechner R, Haemmerle G
Journal of lipid research 2013 Apr;54(4):1092-102
Journal of lipid research 2013 Apr;54(4):1092-102
PNPLA1 mutations cause autosomal recessive congenital ichthyosis in golden retriever dogs and humans.
Grall A, Guaguère E, Planchais S, Grond S, Bourrat E, Hausser I, Hitte C, Le Gallo M, Derbois C, Kim GJ, Lagoutte L, Degorce-Rubiales F, Radner FP, Thomas A, Küry S, Bensignor E, Fontaine J, Pin D, Zimmermann R, Zechner R, Lathrop M, Galibert F, André C, Fischer J
Nature genetics 2012 Jan 15;44(2):140-7
Nature genetics 2012 Jan 15;44(2):140-7
Liver X receptor (LXR) regulates human adipocyte lipolysis.
Stenson BM, Rydén M, Venteclef N, Dahlman I, Pettersson AM, Mairal A, Aström G, Blomqvist L, Wang V, Jocken JW, Clément K, Langin D, Arner P, Laurencikiene J
The Journal of biological chemistry 2011 Jan 7;286(1):370-9
The Journal of biological chemistry 2011 Jan 7;286(1):370-9
B56alpha/protein phosphatase 2A inhibits adipose lipolysis in high-fat diet-induced obese mice.
Kinney BP, Qiao L, Levaugh JM, Shao J
Endocrinology 2010 Aug;151(8):3624-32
Endocrinology 2010 Aug;151(8):3624-32
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ABHD5 expression in transfected 293T cell line by ABHD5 monoclonal antibody (M01), clone 1F3.Lane 1: ABHD5 transfected lysate(39 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ABHD5 monoclonal antibody (M01), clone 1F3. Western Blot analysis of ABHD5 expression in HeLa.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ABHD5 monoclonal antibody (M01), clone 1F3. Western Blot analysis of ABHD5 expression in rat testis.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ABHD5 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ABHD5 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol