Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310341 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Abhydrolase Domain Containing 5 (ABHD5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the N terminal of human ABHD5
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESI
EEWRC ALGLDKMILL- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Clinical and genetic characterization of Chanarin-Dorfman syndrome.
Bruno C, Bertini E, Di Rocco M, Cassandrini D, Ruffa G, De Toni T, Seri M, Spada M, Li Volti G, D'Amico A, Trucco F, Arca M, Casali C, Angelini C, Dimauro S, Minetti C
Biochemical and biophysical research communications 2008 May 16;369(4):1125-8
Biochemical and biophysical research communications 2008 May 16;369(4):1125-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting