HPA003180

TNRC6B antibody from Sigma-Aldrich
KIAA1093
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003180
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003180, RRID:AB_1079196
Product name
Anti-TNRC6B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003180
Antibody type
Polyclonal
Antigen
Trinucleotide repeat-containing 6B protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQ
QEQQLARMVSALQQQQQQQQRQPGMKHSPSHPVGP
KPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSG
GMDYGMVGGKEAGTESRFKQWTS
Storage
-20C
Provider Type Product Number
- No reagents -