HPA052217

VPS25 antibody from Atlas Antibodies
DERP9, EAP20, MGC10540
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA052217
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA052217, RRID:AB_2681765
Product name
Anti-VPS25
Provider product page
Atlas Antibodies - HPA052217
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSL
VLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPV
ESIQIVL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -