HPA015576

GPR161 antibody from Sigma-Aldrich
RE2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015576
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015576, RRID:AB_1849283
Product name
Anti-GPR161 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015576
Antibody type
Polyclonal
Antigen
Probable G-protein coupled receptor 161 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQI
KEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAK
INLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVS
QRLQLQSIEEGDVLA
Storage
-20C
Provider Type Product Number
- No reagents -