HPA015576

GPR161 antibody from Atlas Antibodies
RE2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015576
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015576, RRID:AB_1849283
Product name
Anti-GPR161
Provider product page
Atlas Antibodies - HPA015576
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQI
KEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAK
INLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVS
QRLQLQSIEEGDVLA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -