HPA014087

EDNRA antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014087
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014087, RRID:AB_1847993
Product name
Anti-EDNRA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014087
Antibody type
Polyclonal
Antigen
Endothelin-1 receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQD
VKD
Storage
-20C
Provider Type Product Number
- No reagents -