H00084966-B01P

IGSF21 antibody from Abnova Corporation
MGC15730, RP11-121A23.1

Antibody data

Product number
H00084966-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084966-B01P, RRID:AB_1576251
Product name
IGSF21 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00084966-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human IGSF21 protein.
Antigen sequence
MRTAPSLRRCVCLLLAAILDLARGYLTVNIEPLPP
VVAGDAVTLKCNFKTDGRMREIVWYRVTDGGTIKQ
KIFTFDAMFSTNYSHMENYRKREDLVYQSTVRLPE
VRISDNGPYECHVGIYDRATREKVVLASGNIFLNV
MAPPTSIEVVAADTPAPFSRYQAQNFTLVCIVSGG
KPAPMVYFKRDGEPIDAVPLSEPPAASSGPLQDSR
PFRSLLHRDLDDTKMQKSLSLLDAENRGGRPYTER
PSRGLTPDPNILLQPTTENIPETVVSREFPRWVHS
AEPTYFLRHSRTPSSDGTVEVRALLTWTLNPQIDN
EALFSCEVKHPALSMPMQAEVTLVAPKGPKIVMTP
SRARVGDTVRILVHGFQNEVFPEPMFTWTRVGSRL
LDGSAEFDGKELVLERVPAELNGSMYRCTAQNPLG
STDTHTRLIVFENPNIPRGTEDSNGSIGPTGARLT
LVLALTVILELT
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -