Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005688-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005688-M01, RRID:AB_425628
- Product name
- PSMA7 monoclonal antibody (M01), clone 1A10-3G12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PSMA7.
- Antigen sequence
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGV
RGRDIVVLGVEKKSVAKLQDERTVRKICALDDNVC
MAFAGLTADARIVINRARVECQSHRLTVEDPVTVE
YITRYIASLKQRYTQSNGRRPFGISALIVGFDFDG
TPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKN
YTDEAIETDDLTIKLVIKALLEVVQSGGKNIELAV
MRRDQSLKILNPEEIEKYVAEIEKEKEENEKKKQK
KAS- Isotype
- IgG
- Antibody clone number
- 1A10-3G12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references PSMA7 inhibits the tumorigenicity of A549 human lung adenocarcinoma cells.
Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?
Tan JY, Huang X, Luo YL
Molecular and cellular biochemistry 2012 Jul;366(1-2):131-7
Molecular and cellular biochemistry 2012 Jul;366(1-2):131-7
Proteomic identification of putative biomarkers of radiotherapy resistance: a possible role for the 26S proteasome?
Smith L, Qutob O, Watson MB, Beavis AW, Potts D, Welham KJ, Garimella V, Lind MJ, Drew PJ, Cawkwell L
Neoplasia (New York, N.Y.) 2009 Nov;11(11):1194-207
Neoplasia (New York, N.Y.) 2009 Nov;11(11):1194-207
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PSMA7 monoclonal antibody (M01), clone 1A10-3G12. Western Blot analysis of PSMA7 expression in human omentum, serous carcinoma.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PSMA7 monoclonal antibody (M01), clone 1A10-3G12 Western Blot analysis of PSMA7 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PSMA7 expression in transfected 293T cell line by PSMA7 monoclonal antibody (M01), clone 1A10-3G12.Lane 1: PSMA7 transfected lysate (Predicted MW: 27.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PSMA7 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PSMA7 on HeLa cell. [antibody concentration 1 ~ 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of PSMA7 transfected lysate using anti-PSMA7 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PSMA7 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PSMA7 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PSMA7 on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol