H00085007-B01

PHYKPL antibody from Abnova Corporation
AGXT2L2, MGC15875

Antibody data

Product number
H00085007-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00085007-B01, RRID:AB_1138613
Product name
MGC15875 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00085007-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC15875 protein.
Antigen sequence
MGKSIGNGHPVACVAATQPVARAFEATGVEYFNTF
GGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQ
LLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTP
ATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPM
CFSLDNARQVVAKLDAILTDMEEKVRSCETLRLQP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -