HPA006678

ZNF445 antibody from Sigma-Aldrich
ZKSCAN15, ZNF168, ZSCAN47
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006678
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006678, RRID:AB_10603329
Product name
Anti-ZNF445 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006678
Antibody type
Polyclonal
Antigen
zinc finger protein 445 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPKGNPVAAPTGDDLQSKTNKFILNQEPLEEAETL
AVSSGCPATSVSEGIGLRESFQQKSRQKDQCENPI
QVRVKKEETNFSHRTGKDSEVSGSNSLDLKHVTYL
RVSGRKESLKHGCGKHFRMSSHHYDYKKYGK
Storage
-20C
Provider Type Product Number
- No reagents -