Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN504603 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-G Protein-Coupled Receptor 15 (GPR15) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GPR15 antibody: synthetic peptide directed towards the N terminal of human GPR15
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
FIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFL
CKGSS YMISVNMHCS- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references CCR5, GPR15, and CXCR6 are major coreceptors of human immunodeficiency virus type 2 variants isolated from individuals with and without plasma viremia.
Blaak H, Boers PH, Gruters RA, Schuitemaker H, van der Ende ME, Osterhaus AD
Journal of virology 2005 Feb;79(3):1686-700
Journal of virology 2005 Feb;79(3):1686-700
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting