H00006954-B01

TCP11 antibody from Abnova Corporation
D6S230E, FPPR, KIAA0229

Antibody data

Product number
H00006954-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006954-B01, RRID:AB_1138991
Product name
TCP11 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00006954-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human TCP11 protein.
Antigen sequence
MAPKGILGSFPTAMNLSLEGKVKETVHNAFWDHLK
EQLSATPPDFSCALELLKEIKEILLSLLLPRQNRL
RIEIEEALDMDLLKQEAEHGALKVLYLSKYVLNMM
ALLCAPVRDEAVQKLENITDPVWLLRGIFQVLGRM
KMDMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQ
PSLLNHTTKWLTQAAGDLTMSPPTCPDTSDSSSVA
GPSPNEAANNPEPLSPTMVLCQGFLNLLLWDLENE
EFPETLLMDRTRLQELKSQLHQLTVMASVLLVASS
FSGSVLFGSPQFVDKLKRITKSLLEDFHSRPEEAI
LTVSEQVSQEIHQSLKNMGLVALSSDNTASLMGQL
QNIAKKENCVCSVIDQRIHLFLKCCLVLGVQRSLL
DLPGGLTLIEAELAELGQKFVNLTHHNQQVFGPYY
TEILKTLISPAQALETKVESV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -